07/01/17 Fidget Spinners & New Boots! - Plus more Transmisogyny

  • Twórca wątku Twórca wątku JSGOTI
  • Data rozpoczęcia Data rozpoczęcia
  • 🇵🇦 Nuestro primer dominio localizado está en español en kiwifarms.pa. Our first localized domain is on Spanish on kiwifarms.pa.
  • Want to keep track of this thread?
    Accounts can bookmark posts, watch threads for updates, and jump back to where you stopped reading.
    Create account
I genuinely hope Phil had fun in whatever Army surplus store he bought the boots from because you know that the sales clerk did :story:
 
The Man With No Name powiedział(a):
When Phil dies, it'll take a long time before we find out because nobody will be able to identify the body. None of his family is about to go out to Cali or Oregon to do that. The Rat King isn't going to care about him once he's dead. There's a good chance his gravestone will read Phillip Haskins-Delici too.
Kliknij, aby rozwinąć...

Phil'll end up in an unmarked grave.

This is a very interesting documentary about dying alone:

 
I'm surprised he isn't playing up Daddy Rape Day with it being just around the corner. Don't tell me he's forgotten his favourite and possibly longest ongoing lie?
 
Lysistrata powiedział(a):
I'm surprised he isn't playing up Daddy Rape Day with it being just around the corner. Don't tell me he's forgotten his favourite and possibly longest ongoing lie?
Kliknij, aby rozwinąć...
He's building up to tomorrow's "meltdown" and will need many donations and asspats asap or else

He's been casually dropping hints for a few weeks now that the 4th is oh so traumatic and this year will be the worst ever
 
Hyperion powiedział(a):
He's been casually dropping hints for a few weeks now that the 4th is oh so traumatic and this year will be the worst ever
Kliknij, aby rozwinąć...

Each year is further away from the 'trauma' that occurred, and he's no longer homeless and has more toys than ever to distract himself with.

So yeah, he's going to claim this is his hardest year yet to deal with it. Because he doesn't know how not to be a fraud.
 
JSGOTI powiedział(a):
Well, I guess that we all knew it was only a matter of time before Phil jumped on the bandwagon for fidget spinners, and I guess that he does, techncially, have a 'fidget spinner'... but the quality leaves a great deal to be desired. But, he doesn't care, it's more bike kitsch to fill his apartment with.
https://youtube.com/watch?v=m-WqJ6mH2Vo

In other news, the spudlord has gotten yet another new pair of boots, bringing his collection to a crippling size of probably twenty different pairs at this point at last count. And of course, he has to show them off in a video, because they ARE his identity, after-all.
https://youtube.com/watch?v=wvdwhbaoARM

BONUS CONTENT!
From Instagram
Wyświetl załącznik 241712
CN - Death mention, Transmisogyny and CSA mention
.
.
.
.
.
.
.
When I die, cremation only. I do not want a gravesite, no monument, it would be vandalized/desecrated anyhow by fascists and transmisogynists. I was not given peace alive, I seriously doubt that I would have peace dead if people knew where my corpse were.

I desire my ashes to be dispersed into the Atlantic Ocean and Pacific Ocean. And on land in Mount Hood and Mount Saint Helens.

Fuck every transmisogynist that ever abused and terrorized me. From my rapist father to Kiwi Farms stalkers who continue to threaten the peace and security I am trying to live in and willing to defend.
Kliknij, aby rozwinąć...

I hate everyone and everyone hates me but when I die someone travel across the country to spread my ashes in these specific places....yea ok Phil. Your going to the dump when you die, maybe Tommie will come see you when hes looking for lunch
 
ToroidalBoat powiedział(a):
Phil would likely think "coquí" is some kind of cookie.
Kliknij, aby rozwinąć...
Most likely, I would really love to see him here though, Puerto Ricans don't have tolerance for special snowflakes like him, if he starts shit up they'd kick his ass, especially if he gets with the bad crowd. Not only that cyclists here die almost every month since this place is not bicycle friendly, and without knowing Spanish, he isn't going to do much.
 
Triggered Fivehead powiedział(a):
Phil'll end up in an unmarked grave.

This is a very interesting documentary about dying alone:

https://youtube.com/watch?v=ErooOhzE268
Kliknij, aby rozwinąć...

shouldanameditflipperthewayitliftedmeofftheseat.png

That moment you realize you have more feels for this unknown dying on the shitter than Phil for being alive and panhandling on the Internet.
 
SMELLY LEATHER PANTS (PANTS)
BOOTS WITH THE EDGE (WITH THE EDGE)
AND THE WHOLE CLUB IS POZZIN ON THE REG
PHIL HIT THE FLOOR (HE HIT THE FLOOR), NEXT THANG YOU KNOW,
HIS BALLS DROPPED LOW LOW LOW LOW LOW
 
When one requests an ash dispersal, it is for the benefit of the loved one visiting those areas which the deceased holds dear. The county will be his final companion, and he will receive a pauper's grave.
 
Hyperion powiedział(a):
He's building up to tomorrow's "meltdown" and will need many donations and asspats asap or else

He's been casually dropping hints for a few weeks now that the 4th is oh so traumatic and this year will be the worst ever
Kliknij, aby rozwinąć...

Because it's the 20th anniversary of Daddy Rape Day, of course! The need for financial praxis will be ever more acute!
 
Wasn't he into the environmental stuff for a while? (Is that over now?) If he was, I'm surprised he wasn't pushing for the natural burial. You don't get a marker, so it's not like someone could figure out which grave was his, and its the most environmentally friendly behind Alkaline Hydrolysis (only legal in a few states), then cremation. Direct Cremation is cheapest tho, so I'm guessing that's the real reason he's going for that.
 
Musisz się zalogować lub zarejestrować, aby odpowiedzieć.
Wstecz
Top Na dole