Thread Requests & Resources - If you want to make a thread but don't know how or are too lazy.

  • Twórca wątku Twórca wątku Null
  • Data rozpoczęcia Data rozpoczęcia
  • 🇵🇦 Nuestro primer dominio localizado está en español en kiwifarms.pa. Our first localized domain is on Spanish on kiwifarms.pa.
  • Want to keep track of this thread?
    Accounts can bookmark posts, watch threads for updates, and jump back to where you stopped reading.
    Create account
I mean, I thought walking around in public with a fuckin puppet trying to get randos to talk to it was pretty spergic. And being super serious about it, like fuckin giving interviews with the puppet on other YouTube channels. But not like a muppet or shit. Just him sitting there talking like he’s the puppet when you just see him. Not a ventriloquist either, just talking as the puppet like a fuckin weirdo. And the fact that he’s gone from being a fairly standard manchild to getting weirder and more tranny-loving since his wife left makes me think he’s just waiting for a good solid push. But that’s just my opinion. Others could fail to see the fun here.
Fair enough but like I said kinda like another manchild on the web.
 
More from self-described AI Warfare Expert, Patrick Ryan. Apparently he's having trouble with Jewish Space Lasers from the British Empire causing him to have tinnitus.

image_2023-03-06_114601273.png


giganticdeusionsofshinglesgrandeur.JPG


And he claims this is because he's trying "to stop WWIII" and that it's also why he got slapped with Weaponied Shingles Virus at CPAC 19. (Someone should have told him that all politics are glowies.)

Deulsionalmachinecultistspergout.JPG

And apparently Patrick is also the reason your GPU costs way too much because he wants to use AI to own the "artcels" and "wordcels".

hedoesntbelieveinagency.JPG

He also increasingly spergs out about Agency and how it doesn't exist, the further he gets into his AI Machine Cultist LARP.
 

Załączniki

  • doeshesupportbeltandroad.JPG
    doeshesupportbeltandroad.JPG
    63,8 KB · Wyświetlenia: 34
  • hethinkssethmacfarlanewassavedbyaspy.JPG
    hethinkssethmacfarlanewassavedbyaspy.JPG
    30,9 KB · Wyświetlenia: 21
Has anyone done any digging on "Ty Delorean"? Dude says he is the secret son of John Delorean and tried to build a new delorean out of a 3 wheel car. He's had meltdowns on various Facebook groups and Tiktok and most recently has popped up in Bali (escaping lawsuits from actual Delorean motor Co). He was arrested making a scene at a memorial of the Bali Bombing. There's something very pedo about him and he's currently selling pancakes or some shit from a roadside shack, still using the DM branding.
 
Ino Noberg / Ino Andre Lonne Noberg / Ino Andre Kitakaze
An "edgy nazi femboy", compulsive liar, and domestic abuser. Made up fake stories about how he was abused and ended up homeless, someone fell for it and sent money his way, only for him to mock them behind their back. Grouped up with other trannies in some crackhouse style arrangement, kind of like the Final Fantasy House, one night he took LSD and molested his tranny "girlfriend." Police were called and he's currently being held in the Greenup County Detention Center. If sentenced I don't think a femboy with sexual assault charges will last long in an American prison. Will update when I get more info about the case, currently trying to request bodycam footage of the arrest.
Arrest Info: https://kentucky.arrests.org/Arrests/Ino_Noberg_55111896/ (archive)
4chan thread: https://boards.4chan.org/r9k/thread/72471310 (archive) (Do note that some info was deleted for "dox" despite being public info, and was not archived in time)
Facebook post by some generic news site, a few comments are from people who thought he was a girl lol.
crime scene.jpg

kentucky.arrests.org.png
 

Załączniki

  • Extra Charge Info.jpg
    Extra Charge Info.jpg
    73,6 KB · Wyświetlenia: 90
  • Extra Charge Info.jpg
    Extra Charge Info.jpg
    73,6 KB · Wyświetlenia: 100
  • Ino 1.jpg
    Ino 1.jpg
    25,3 KB · Wyświetlenia: 95
  • ino 2.jpg
    ino 2.jpg
    285,6 KB · Wyświetlenia: 103
  • Ino 3.png
    Ino 3.png
    1,5 MB · Wyświetlenia: 101
  • Ino Facebook.png
    Ino Facebook.png
    1,2 MB · Wyświetlenia: 125
  • Most Viewed.jpg
    Most Viewed.jpg
    192,3 KB · Wyświetlenia: 98
  • Mugshot.jpg
    Mugshot.jpg
    64,1 KB · Wyświetlenia: 105
  • patriot front fed group larp.png
    patriot front fed group larp.png
    47,3 KB · Wyświetlenia: 105
  • vinelink.vineapps.com.png
    vinelink.vineapps.com.png
    145,6 KB · Wyświetlenia: 112
Ostatnio edytowane:
Ino Noberg / Ino Andre Lonne Noberg / Ino Andre Kitakaze
An "edgy nazi femboy", compulsive liar, and domestic abuser. Made up fake stories about how he was abused and ended up homeless, someone fell for it and sent money his way, only for him to mock them behind their back. Grouped up with other trannies in some crackhouse style arrangement, kind of like the Final Fantasy House, one night he took LSD and molested his tranny "girlfriend." Police were called and he's currently being held in the Greenup County Detention Center. If sentenced I don't think a femboy with sexual assault charges will last long in an American prison. Will update when I get more info about the case, currently trying to request bodycam footage of the arrest.
Arrest Info: https://kentucky.arrests.org/Arrests/Ino_Noberg_55111896/ (archive)
4chan thread: https://boards.4chan.org/r9k/thread/72471310 (archive) (Do note that some info was deleted for "dox" despite being public info, and was not archived in time)
Facebook post by some generic news site, a few comments are from people who thought he was a girl lol.
Wyświetl załącznik 4717710
Wyświetl załącznik 4717688
Actual horror, what the fuck
 
i want to submit stalwart troon and keffals defender demonintheshell, a self admitted pedophile who talking about threesome with toddlers in youtube comments and writes stories about raping children
10.png 9.png 8.png 7.png 6.png 5.png 4.png 3.png 2.jpg 1.jpg
him talking about sex with toddlers here: https://www.youtube.com/watch?v=zwY-lDQh3Ck

he links to pedo stories he's written on his profile.

the young turks legal department have been told about him numerous times and refuse to remove him from the channel
 
Ostatnio edytowane przez moderatora:
Harry Mountbatten-Windsor - ex-royal, still using the title of PRINCE in all his lawsuits though & demanded the King make his kids prince & princess, also go mad bc his older brother had 1 more sausage then he did
Meghan Markle - though there are places all over the internet dedicated to this grifter, the Kiwifarms treatment would be divine.
 
Has there been a thread made on Greg Sepelak/M. Sipher of the TFWiki cabal yet? He's a friend of David Willis, and he basically all but admitted to trading a rare Transformer for a blowjob from a 16 year old boy.
 
Do you guys think a general thread about twitch could make sense?
I had the idea to make this thread because of the deefake porn drama which was weirdly enough discussed in the youtube thread.


The girls at LCF have one

It's mostly about twitch and streamer culture. Streamers and streamer groups have a ton of drama and controversies and most of them as individuals are not thread worthy on their own imo.

-the gambling streams
-the bikini streaming stuff
-the whole deep fake porn drama
-the xqc divorce saga
-justaminx being an alcoolic asshole
-the rape/sexual abuse allegations/cover up
-General twich ultra autism with donos and sub marathons
-the ship culture
-the streaming groups internal dramas
- the streamer leeching other (Esfand gets leeched by former camgirls)
-Former pornstars trying to be streamers etc.

Here's a few stuff that could fall into this.
 
Ostatnio edytowane:
Do you guys think a general thread about twitch could make sense?
I had the idea to make this thread because of the deefake porn drama which was weirdly enough discussed in the youtube thread.


The girls at LCF have one

It's mostly about twitch and streamer culture. Streamers and streamer groups have a ton of drama and controversies and most of them as individuals are not thread worthy on their own imo.

-the gambling streams
-the bikini streaming stuff
-the whole deep fake porn drama
-the xqc divorce saga
-justaminx being an alcoolic asshole
-the rape/sexual abuse allegations/cover up
-General twtich ultra autism with donos and sub marathons
-the ship culture
-the streaming groups internal dramas
- the streamer leeching other (Esfand gets leeched by former camgirls)
-Former pornstars trying to be streamers etc.

Here's a few stuff that could fall into this.
I'm surprised there isn't already one, Twitch constantly has drama to keep it going
 
I'm here to expose an malignant narcissist & abuser. The result of the abuse resulted in one of my best friends suicide. She's also extremely delusional and lies.
I'm not sure if she'd fall under skitzocow or horrorcow, but it seems that now this trainwreck may have turned into a lolcow. You decide.

TLDR:https://www.facebook.com/groups/janaejones/


I want preface this stating what my friend did was terrible to his wife. However, I believe a lot of the relationship was coerced with threats of violence and false rape reports. I really believe he was scared of losing everything. He was in the military. A civilian accusing a service member of rape is taken very seriously and can be life ruining.


ENTER JANAE JONES
banner.jpg

Timeline of events:

August/September 2022
-friend goes to NE for leave, has an affair with this skank
-He calls and tells his wife of affair, wife is pissed but they can work through it
-Janae calls the wife to "apologize' because she "feels bad, " puts an unloaded pistol to her head that my friend had to take away and hide from her

337100006_712944320573305_708812238897481026_n.jpg 337161234_894898101622168_2559525621853031582_n.jpg





October 2022
-Friend makes the choice, chooses the crazy bitch over his wife
-makes it facebook official, anyone who disagrees is cut off from communication (everyone who cared and knew she was crazy)
-flies her down on the weekend
-one weekend they got a hotel room. She proceeded to bash his head into the wall, threatened to tell the police he raped her. She did called the police
(not entirely sure what happened)
-he continues to fly her out and stay at the house that his wife is still living at together. The wife can't kick her out or do anything about it per Virginia law
-Janae sends the wife (who is also my best friend) this message......


Wyświetl załącznik video-38ae5ed0-451e-427e-ac2f-7783cdef5ab7-1680390503.mp4

November
-Janae is arrested for domestic abuse and public intoxication, not entirely sure about the location but they were out in public
-Janae moves to Virginia from Nebraska (with the wife still residing)
dv and drunk.jpg
December/January
-not much is discussed other than the fighting that is happening between Janae and the husband
-The move out into military housing, she signs papers posing as the wife

*divorce papers were never filed, nor did they go to mediation after the wife had requested for months to do so*

February
-Janae now only refers to him as the "roommate"
-My friend calls his mother about a week (maybe more or less) before his suicide and says all his friends hate him
-My friend ends his life. He and Janae were fighting. He went and in the bathroom and that was that. She was home the entire time
-she attempted/failed cpr, she ride with him to the hospital
-He's brain dead, a vegetable...not ever coming back from that
-family bans her from the hospital, she sends the wife this message......

IMG_8522.JPG IMG_8523.JPG



-she is kicked out of housing (she's not supposed to be living there)
-she takes all of his electronics, military awards, military uniform, etc and stays with a friend
-she authors her own obituary for him https://www.legacy.com/us/obituaries/legacyremembers/stephen-parton-obituary?id=44563733
-she's upset that the family is telling people her memorial service is not the official service
-Janae calls Stephen's mother the night before the funeral and leaves a nasty message
-she checks into the psych hospital for 10 or so days
-I fly in to be there for my friend and attend his service. I see the evidence of a time she abused him, cops were called but nothing was done. You can see in the video that he was trying to get away from her from where the blood spatter is.
-There is audio proof of abuse and her telling him to hang himself. The owner of said material is waiting to release it. Stephen's death is still under investigations.

Wyświetl załącznik 9E80760F-FF2A-4903-AD08-8C862D854D7B.mp4
-His fb page is taken down after the death cert is received

-Janae makes her own fb page for him that supposed to be a "in memory" page. She only posts on it to feed her narcisissm and look like a grieving "widow" (remember she broke up with him before his suicide) https://www.facebook.com/search/top?q=memoryof stephenparton

After his death, we thought all of this would be the last of her....
We were wrong

-She refused to return the car key and his items. she took all of his video games. He was a collector. He has old systems, old games and new systems that I luckily had pics of from past conversations.
-She turns on the friend she's staying with. I'll call the friend "Laura". She accused Laura's friend of sexually assaulting her. What happened was Janae picked yet another fight with a dude and was restrain. Laura took her kids and stayed in a hotel. Janae has to leave the premises. Laura was able to recover what Janae stole
-Janae moves in with Jack. jack is an 18 year old from the psychward she met during her stay. They live in the guest house at his parents house

March
-She makes false police report that the wife "stole' her pink gun. Wife doesn't have it and hates pink. Wife lets the cops come in and said they could search if they wanted to
-Janae goes back to Nebraska to hold a "celebration of life"
-Janae is actually there for court (fraud case)
-She brings 18year old boyfriend with her (she's 35)
planejpg.jpg
-then there's this ^
-Janae authors a gofund me and asks a friend(jackie) to post it. The friend is completely unaware of the situation until a friend of mine (kelly) calls out the post.
-Jackie reaches out to Kelly, Kelly gives the scoop of the affair, abuse, narcissim, etc.
-Jackie confronts Janae, Janae threatens to kill herself and report Jack for rape
-Janae gets the boot and is taken to the psychward
336883937_3367926630188895_3370364476756905581_n.jpg
-Jackie get other items Janae stole back to the parents in NE
-Jackie warns 18yearold about Janae. 18year old flies back to VA, Janae is no longer allowed to stay at the house. the parents didnt know she was staying there.
-Janae calls police on Jackie for stealing her rings. When Jackie gave the items to the parents she didnt know the rings weren't Stephen's because a set of rings was reported stolen with the property. Jackie had no intent and can't be charged. She had to return them by 4pm last monday.
-a facebook group is born
https://www.facebook.com/groups/janaejones/

-Janae catches wind about it and says everything is photoshopped
-She makes her back to VA
-this week Janae makes an anonymous call to animal control saying my friend abuses her cats, my friend let animal control come in an look around. nothing happened, but she is still giving the wife issues by making calls. There is also suspicion that she is trying to get records of the wife and the minor daughter under a false name. The sheriff's department notified them with a formal letter that someone named L*** is trying to get information. L*** is one of the people Janae burned in VA and L*** isnt her full name.

, -Now Janae and Jack are living in a tent. The 5 posts a day about Stephen have stopped. She's moved on to her next victim
tent.jpg
IMG_9226.PNG



These are pretty much the high points of the saga.

Since the facebook was made, other testimonies and documents have been revealed. She has a history of reporting false rape reports and assault. She also has a long history of picking fights with men, and beating on her partners. Male victims of domestic abuse aren't taken seriously.


Other relevant information:

dv1.jpg

fight.jpg fight2.jpg fight3.jpg

report.jpg report 1.jpg

Relevant links:

https://www.facebook.com/janae.jones.984786

https://www.tiktok.com/@jackandjill...GaBXjUjJpKJiLz-Jy-1aWLtEC9b3fwQiu88gfc8H6DJJo

https://www.tiktok.com/@janaeciousd...6gxSmfSCjZ0NyIxdQVDpBGRUKj21ikQSfeG6WUK3b-Xv8

https://www.reddit.com/user/IllAd5336?utm_source=share&utm_medium=ios_app&utm_name=iossmf

https://onlyfans.com/virginabeachan...DI4W-IzMlsEp5zX7EKPSk1b_zS-2_ClUevxM9VzcKZh-c


https://www.reddit.com/user/angelfr...ave_over_300_unread_messages_i_cannot_get_to/

https://inmate.watch/details/95090/...mVl2Ih3pCpZdzqFzf_ICSG2i6MFSDA8RWg7b9RWhlwUoM

https://virginiapeninsulajailva.mugshots.zone/jones-janae-yardley-mugshot-11-05-2022/

https://www.facebook.com/search/top?q=memoryof stephenparton
 

Załączniki

  • IMG_9226.PNG
    IMG_9226.PNG
    5,2 MB · Wyświetlenia: 29
Ostatnio edytowane przez moderatora:
Wstecz
Top Na dole